PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539243.1_FGP005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 377aa    MW: 41376.2 Da    PI: 8.1149
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539243.1_FGP005genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS318.21.7e-977037769374
               GRAS  69 tseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skee 157
                        +++  s+e +  +k++++++P+ kf+hltaNqaIlea+  ++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++RiTgv sp  g   + +
  KN539243.1_FGP005  70 DARFASDELTLCYKTLNDACPYSKFAHLTANQAILEATGAATKIHIVDFGIVQGIQWAALLQALATRPEGKPtRIRITGVPSPLLGpqPAAS 161
                        344448889999********************************************************88777*********998888999* PP

               GRAS 158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhn 249
                        l +t+ rL++fA+ lgv+fef + + + +++l+ +++ v+p+Ea+aVn++lql++ll +s +l     +vL+l kslsP vv++ e e+++n
  KN539243.1_FGP005 162 LAATNTRLRDFAKLLGVDFEFVP-LLRPVHELNKSDFLVEPDEAVAVNFMLQLYHLLGDSDELVR---RVLRLAKSLSPAVVTLGEYEVSLN 249
                        ***********************.599******************************88888877...************************ PP

               GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                        ++ F++rf++al+yy +lf+sl++ + r+s er+ vEr ++g++i+ +v   ega+r+er+   ++W+  +e +GF+pvpls++a +qa+ll
  KN539243.1_FGP005 250 RAGFVDRFANALSYYRSLFESLDVAMTRDSPERARVERWMFGERIQRAVGpEEGADRTERMAGSSEWQTLMEWCGFEPVPLSNYARSQADLL 341
                        *************************************************8356889************************************ PP

               GRAS 341 lrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                        l +++ +  y++ e   +++ l W++rpL++vSaWr
  KN539243.1_FGP005 342 LWNYDsKYKYSLVELPPAFLsLAWEKRPLLTVSAWR 377
                        *****7778999999999988**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.2641355IPR005202Transcription factor GRAS
PfamPF035146.0E-9570377IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MAGGARGAAR RHGAGGAEGR RGDLRNRTDQ RSGWRGNMCG PACAVGGGGR EDLLGRLACG  60
TGAPPPAAPD ARFASDELTL CYKTLNDACP YSKFAHLTAN QAILEATGAA TKIHIVDFGI  120
VQGIQWAALL QALATRPEGK PTRIRITGVP SPLLGPQPAA SLAATNTRLR DFAKLLGVDF  180
EFVPLLRPVH ELNKSDFLVE PDEAVAVNFM LQLYHLLGDS DELVRRVLRL AKSLSPAVVT  240
LGEYEVSLNR AGFVDRFANA LSYYRSLFES LDVAMTRDSP ERARVERWMF GERIQRAVGP  300
EEGADRTERM AGSSEWQTLM EWCGFEPVPL SNYARSQADL LLWNYDSKYK YSLVELPPAF  360
LSLAWEKRPL LTVSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.05637754375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1469360.0AC146936.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone B1154F06 map near C10769, complete sequence.
GenBankAK0640220.0AK064022.1 Oryza sativa Japonica Group cDNA clone:001-125-A04, full insert sequence.
GenBankAK1016030.0AK101603.1 Oryza sativa Japonica Group cDNA clone:J033051K20, full insert sequence.
GenBankAK1028570.0AK102857.1 Oryza sativa Japonica Group cDNA clone:J033110P03, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628849.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL031e-132SCL4_ARATH; Scarecrow-like protein 4
TrEMBLA0A0D3FNF00.0A0A0D3FNF0_9ORYZ; Uncharacterized protein
TrEMBLI1PI810.0I1PI81_ORYGL; Uncharacterized protein
STRINGORGLA03G0407700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-133GRAS family protein